PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00116897001
Common NameGSBRNA2T00116897001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 343aa    MW: 39202.3 Da    PI: 7.0149
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00116897001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.3e-3262115255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH rFv+ave+LGG+e+AtPk ++++m++kgL+++hvkSHLQ+YR+
  GSBRNA2T00116897001  62 PRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQMYRS 115
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.27358118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2958116IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1460116IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2262117IPR006447Myb domain, plants
PfamPF002491.2E-963114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MIPSMDGSGK TTDREEEEEE EEEEEEEEDG EGEESKVSSN TTVEAEVGKK TKVRPYVRSK  60
VPRLRWTPDL HLRFVRAVER LGGQERATPK LVRQMMNIKG LSIAHVKSHL QMYRSKKMDD  120
QGQAIADNRH FIESSTDRNI YKLSQLPMFR GYNTNHSHDS PFRYGSRFSN ASLWNSSSHE  180
TNRSLIDRTG LIRGSSVSNN IHVSEYWTNN RSFQNTYSSS VSNHLPKVRH NHQERNNLAT  240
FNSIQGHSRT FEKFETGIEE RTNHVYCTKT TGKRNASTSL DLDLSLKLRV PEETTLEETE  300
TATTDQTLSL SLCSWKKSRV IKTDEEDRTV KIGQASTLDL TL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00116897001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634096.10.0PREDICTED: putative two-component response regulator ARR20
RefseqXP_013705129.10.0PREDICTED: putative two-component response regulator ARR20
RefseqXP_013705130.10.0PREDICTED: putative two-component response regulator ARR20
TrEMBLA0A078CIL40.0A0A078CIL4_BRANA; BnaA05g06440D protein
STRINGBra005124.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-166G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]